top of page

Search this site

4265 results found

  • Aniracetam API | CAS 72432-10-1 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Aniracetam CAS 72432-10-1? Conscientia Industrial is a leading manufacturer & supplier of high-purity Aniracetam in China. Offering ≥99.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. ISO certified, GMP compliance. Home > Nootropics > Aniracetam Aniracetam API | CAS 72432-10-1 Manufacturer & Supplier in China Looking for Aniracetam CAS 72432-10-1? Conscientia Industrial is a leading manufacturer & supplier of high-purity Aniracetam in China. Offering ≥99.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. Product Overview Aniracetam (CAS 72432-10-1) is a fat-soluble pyrrolidinone compound and a potent analog of the original racetam family. Within the Nootropics and neuroscience research sectors, it is highly recognized for its technical capacity to modulate AMPA receptors and facilitate cholinergic neurotransmission in laboratory models. As a leading manufacturer of Aniracetam CAS 72432-10-1 based in China, Conscientia Industrial employs precise organic synthesis and controlled cooling crystallization to achieve superior batch-to-batch uniformity and a refined crystalline state. Our product adheres to rigorous purity standards to satisfy global technical demands for cognitive research and high-end chemical formulation. Technical Specifications Product Name: Aniracetam CAS Number: 72432-10-1 Category: Nootropics Quality Standard: In-House Purity (HPLC): ≥99.0% Molecular Formula: C12H13NO3 Molecular Weight: 219.24 Appearance: White to off-white powder Melting Point: 120°C - 122°C Residue on Ignition: ≤0.1% Loss on drying: ≤1.0% Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Nootropic Synthesis Expertise: Specialized in the production and purification of racetam-class cognitive enhancers and neuroprotective agents. Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Aniracetam CAS 72432-10-1. Advanced Analytical Verification: Every batch is validated through HPLC and Proton NMR to confirm chemical identity and ensure a clean impurity profile. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA). Scalable Production Capacity: Our China facility is equipped to support projects ranging from pilot-scale laboratory research to large-scale bulk industrial supply. Direct Source Advantage: As a primary manufacturer, we provide Aniracetam CAS 72432-10-1 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 1kg/bag, 25kg/fiber drum, or custom vacuum-sealed packaging according to requirements. Storage Conditions: Store in a cool, dry place. Keep the container tightly sealed and protected from light and moisture. Shelf Life: 24 months. Safety Handling: This is a technical-grade raw material intended for professional industrial production and laboratory research use only. Our logistics team ensures safe delivery of Aniracetam CAS 72432-10-1 by courier / air / sea. Request a Quote & COA for Aniracetam CAS 72432-10-1 Today. Related Products 9-Me-BC Anzurogenin D NSI-189 Galantamine Hydrobromide Piracetam Featured Peptides 98%+ Purity Demoxytocin Jelleine-I Linaclotide Gastric Inhibitory Polypeptide (porcine) C-Reactive Protein (CRP) (77-82) Expert Review Rating: 5/5 ★★★★★ Dr. Elena Rossi (Lab Manager) We bought batches of ingredients from Conscientia Industrial, and our lab tests and productions have shown consistent high purity and performance with this specific grade.

  • Dulaglutide API | CAS 923950-08-7 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Dulaglutide CAS 923950-08-7? Conscientia Industrial is a leading manufacturer & supplier of high-purity Dulaglutide in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. ISO certified, GMP compliance. Home > Peptides > Dulaglutide Dulaglutide API | CAS 923950-08-7 Manufacturer & Supplier in China Looking for Dulaglutide CAS 923950-08-7? Conscientia Industrial is a leading manufacturer & supplier of high-purity Dulaglutide in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. Product Overview Dulaglutide (CAS 923950-08-7) is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist designed through recombinant DNA technology. It consists of two identical disulfide-linked chains, each containing a human GLP-1 analogue sequence covalently linked to a modified human immunoglobulin G4 (IgG4) heavy chain fragment. Within the Peptides and biopharmaceutical research sectors, Dulaglutide is highly valued for its technical capacity to enhance glucose-dependent insulin secretion and suppress glucagon release in advanced biochemical models. As a leading manufacturer of Dulaglutide CAS 923950-08-7 based in China, Conscientia Industrial utilizes precision biotechnology and high-resolution purification platforms to ensure the highest structural integrity and sequence fidelity. Our product maintains a strict purity profile to meet global technical requirements for large-molecule peptide research and batch-to-batch consistency in therapeutic development. Technical Specifications Product Name: Dulaglutide CAS Number: 923950-08-7 Sequence: HGEGTFTSDV SSYLEEQAAK EFIAWLVKGG GGGGGSGGGG SGGGGSAESK YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG Category: Peptide Quality Standard: In-House Purity (HPLC): ≥98.0% Molecular Formula: C2646H4044N704O836S18 Molecular Weight: 59669.93 Appearance: White to off-white powder Single Impurity: ≤1.0% Water Content: ≤8.0% Acetate Content: ≤15.0% Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Expertise in Complex Peptides: Specialized in the synthesis and purification of long-chain and fusion protein analogues with high structural precision. Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Dulaglutide CAS 923950-08-7. Advanced Analytical Verification: Every batch is validated through Size Exclusion Chromatography (SEC-HPLC) and Peptide Mapping to confirm chemical identity and ensure minimal high-molecular-weight aggregates. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Dulaglutide CAS 923950-08-7. Scalable Production Capacity: Our China facility is equipped to support projects ranging from pilot-scale laboratory research to large-scale bulk industrial supply of recombinant peptides. Direct Source Advantage: As a primary manufacturer, we provide Dulaglutide CAS 923950-08-7 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 10mg, 100mg, 1g, 10g, 100g in sealed aluminum foil bags. Storage Conditions: Store at -20°C. Keep the container tightly sealed and protected from light and moisture to maintain maximum stability for Dulaglutide CAS 923950-08-7. Shelf Life: 24 months when stored under recommended conditions. Safety Handling: This is a professional-grade API intended for industrial production and laboratory research use only. Our logistics team ensures safe delivery of Dulaglutide CAS 923950-08-7 by courier, and by air. Request a Quote & COA for Dulaglutide CAS 923950-08-7 Today. Related Products TLQP-30 Vapreotide Acetate Ghrelin Human Murepavadin Tesamorelin Acetate Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Plantainoside D | CAS 147331-98-4 Manufacturer & Supplier in China | Conscientia Industrial

    Are you looking for Plantainoside D (CAS 147331-98-4)? Conscientia Industrial is a trusted Plantainoside D manufacturer and supplier in China, offering ≥98.0% purity, ready stock, complete technical documentation, and reliable worldwide shipping. Request price and COA today. ISO certified, GMP compliance. Home > Plant Extracts > Plantainoside D Plantainoside D | CAS 147331-98-4 Manufacturer & Supplier in China Are you looking for Plantainoside D (CAS 147331-98-4)? Conscientia Industrial is a trusted Plantainoside D manufacturer and supplier in China, offering ≥98.0% purity, ready stock, complete technical documentation, and reliable worldwide shipping. Request price and COA today. Product Overview Plantainoside D (CAS 147331-98-4) is a natural phenylpropanoid glycoside compound isolated from Plantago species. It is used in pharmacological research and cosmetic formulation studies for its antioxidant properties and radical scavenging activities. Conscientia Industrial extracts and purifies Plantainoside D through precision botanical extraction and preparative chromatography to ensure consistent active content and high chemical purity. Technical Specifications Product Name: Plantainoside D CAS Number: 147331-98-4 Category: Plant Extracts Quality Standard: In-House Specification Molecular Formula: C29H36O16 Molecular Weight: 640.59 Appearance: Off-white to light yellow powder Purity (HPLC): ≥98.0% Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Molecular Structure: Why Choose Conscientia Industrial Quality Assurance: Our quality control laboratory tests every batch of Plantainoside D using validated HPLC analysis to ensure strict compliance with technical specifications. Documentation: We provide a complete documentation package for Plantainoside D (CAS 147331-98-4), including the Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA). Production Capacity: Our manufacturing infrastructure supports flexible supply options for Plantainoside D, ranging from R&D scale quantities to large commercial scale orders. Direct Source Advantage: As a direct China manufacturer, Conscientia Industrial offers Plantainoside D with competitive pricing, stable inventory, and direct technical support. Packaging & Storage Packaging: Supplied in 100mg, 1g, 5g, 10g, 100g glass vials, and 1kg aluminum foil bags. Customized packaging and private labeling services are available upon request. Storage Condition: Store in a tightly closed container at 2°C to 8°C, protected from direct sunlight, heat, and moisture. Shelf Life: 24 months when stored under recommended conditions. Safety Handling: This material is for research and industrial use only. Not for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment. Shipping & Quotes Conscientia Industrial provides worldwide logistics solutions for Plantainoside D (CAS 147331-98-4), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements. Contact us today for the latest quotation, COA, MSDS, and technical documentation for Plantainoside D (CAS 147331-98-4). Related Products Salvianolic Acid D 20R-Ginsenoside Rh2 Cafestol (±)-Naringenin Glucosinalbin Featured Peptides 98%+ HPLC Purity Dasiglucagon Vosoritide Acetyl-Pepstatin CD31 Deslorelin Acetate Expert Review Rating: 5/5 ★★★★★ Mark Jensen (Production Manager) The extract shows consistent quality with a well-controlled active compound profile. It performs reliably in both liquid and powder formulations, with good color stability and low odor impact. Overall performance remains excellent for our cosmetic and nutraceutical applications.

  • Rac1 Inhibitor W56 | CAS 1095179-01-3 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Rac1 Inhibitor W56 (CAS 1095179-01-3)? Conscientia Industrial is a professional manufacturer and supplier in China, offering ≥98.0% purity, reliable supply, complete technical documentation, and worldwide shipping. Contact us for the latest price, COA, and MSDS. ISO certified, GMP compliance. Home > Peptides > Rac1 Inhibitor W56 Rac1 Inhibitor W56 | CAS 1095179-01-3 Manufacturer & Supplier in China Looking for Rac1 Inhibitor W56 (CAS 1095179-01-3)? Conscientia Industrial is a professional manufacturer and supplier in China, offering ≥98.0% purity, reliable supply, complete technical documentation, and worldwide shipping. Contact us for the latest price, COA, and MSDS. Product Overview Rac1 Inhibitor W56 (CAS 1095179-01-3) is a synthetic peptide derived from the residues 45-55 of the Rac1 protein, designed to block the interaction between Rac1 and its guanine nucleotide exchange factors (GEFs). It is widely utilized to study Rac1-mediated signal transduction pathways, actin cytoskeleton dynamics, and cell migration mechanisms. Conscientia Industrial manufactures Rac1 Inhibitor W56 through solid-phase peptide synthesis (SPPS) and precision chromatographic purification to ensure high sequence integrity and chemical purity. Technical Specifications Product Name: Rac1 Inhibitor W56 CAS Number: 1095179-01-3 Sequence: Met-Val-Asp-Gly-Lys-Pro-Val-Asn-Leu-Gly-Leu-Trp-Asp-Thr-Ala-Gly Category: Peptides Quality Standard: In-House Specification Molecular Formula: C74H117N19O23S Molecular Weight: 1672.90 Appearance: White to off-white lyophilized powder Purity (HPLC): ≥98.0% Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Molecular Structure: Why Choose Conscientia Industrial Quality Assurance: HPLC and mass spectrometry testings confirm the sequence identity and purity of Rac1 Inhibitor W56. Documentation: Complete analytical reference materials are provided for Rac1 Inhibitor W56 (CAS 1095179-01-3), including the COA, MSDS, and Method of Analysis (MOA). Production Capacity: Our China facility supports Rac1 Inhibitor W56 requirements ranging from R&D quantities to commercial scale quantities. Direct Source Advantage: Direct manufacturing allows competitive price, and technical support for Rac1 Inhibitor W56. Packaging & Storage Packaging: 10mg, 100mg, 1g, 10g, 100g vials or bottles. Customized packaging and private labeling services are available upon request. Storage Condition: Store in a tightly sealed container at -20°C, protected from light and moisture. Shelf Life: 24 months when stored according to recommendations. Safety Handling: This material is for research and industrial use only. Not for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment. Shipping & Quotes Conscientia Industrial provides worldwide logistics solutions for Rac1 Inhibitor W56 (CAS 1095179-01-3), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements. Contact us today for the latest quotation, COA, MSDS, and technical documentation for Rac1 Inhibitor W56 (CAS 1095179-01-3). Related Products Melanotan I Hirudin Difelikefalin Bremelanotide Acetate FAPI-46 Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Cilengitide API | CAS 188968-51-6 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Cilengitide CAS 188968-51-6? Conscientia Industrial is a leading manufacturer & supplier of high-purity Cilengitide in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. ISO certified, GMP compliance. Home > Peptides > Cilengitide Cilengitide API | CAS 188968-51-6 Manufacturer & Supplier in China Looking for Cilengitide CAS 188968-51-6? Conscientia Industrial is a leading manufacturer & supplier of high-purity Cilengitide in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. Product Overview Cilengitide (CAS 188968-51-6) is a potent and selective cyclic pentapeptide antagonist of the integrins alphavbeta3 and alphavbeta5. Within the Peptides and oncology research sectors, it is highly valued for its technical role in inhibiting integrin-mediated cell adhesion and signaling, which are critical pathways in angiogenesis and tumor cell migration. As a leading manufacturer of Cilengitide CAS 188968-51-6 based in China, Conscientia Industrial utilizes advanced solid-phase peptide synthesis (SPPS) and high-performance liquid chromatography purification to ensure high structural integrity and specific binding affinity. Our product maintains a strict purity profile to meet global technical requirements for targeted research and advanced biochemical studies. Technical Specifications Product Name: Cilengitide CAS Number: 188968-51-6 Sequence: Cyclo(Arg-Gly-Asp-D-Phe-N-Me-Val) Category: Peptides Quality Standard: In-House Purity (HPLC): ≥98.0% Molecular Formula: C27H40N8O7 Molecular Weight: 588.66 Appearance: White to off-white powder Single Impurity: ≤1.0% Water Content: ≤8.0% Solubility: Soluble in water Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Cyclic Peptide Expertise: Specialized in the synthesis of constrained cyclic RGD peptides with high structural precision. Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Cilengitide CAS 188968-51-6. Advanced Analytical Verification: Every batch is validated through HPLC and Mass Spectrometry (MS) to confirm chemical identity and ensure precise peptide purity levels. Full Technical Documentation: We provide comprehensive support for Cilengitide CAS 188968-51-6, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA). Scalable Production Capacity: Our China facility is equipped to support projects ranging from milligram-scale laboratory research to large-scale bulk industrial supply. Direct Source Advantage: As a primary manufacturer, we provide Cilengitide CAS 188968-51-6 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 10mg, 100mg, 1g in vials or custom bulk vacuum-sealed aluminum foil bags. Storage Conditions: Store at -20°C. Keep the container tightly sealed and protected from light and moisture to maintain peptide bioactivity. Shelf Life: 24 months when stored under the recommended conditions in the original sealed packaging. Safety Handling: This is a technical-grade API intended for industrial production and laboratory research use only. Our logistics team ensures safe delivery of Cilengitide CAS 188968-51-6 by courier and by air. Request a Quote & COA for Cilengitide CAS 188968-51-6 Today. Related Products Rapastinel Trifluoroacetate Murepavadin Myristoyl Pentapeptide-4 Fibroblast Growth Factor Melanotan I Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Desmopressin Acetate Trihydrate API | CAS 62357-86-2 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Desmopressin Acetate Trihydrate CAS 62357-86-2? Conscientia Industrial is a leading manufacturer & supplier of high-purity Desmopressin Acetate Trihydrate in China. Offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. ISO certified, GMP compliance. Home > Peptides > Desmopressin Acetate Trihydrate Desmopressin Acetate Trihydrate API | CAS 62357-86-2 Manufacturer & Supplier in China Looking for Desmopressin Acetate Trihydrate CAS 62357-86-2? Conscientia Industrial is a leading manufacturer & supplier of high-purity Desmopressin Acetate Trihydrate in China. Offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. Product Overview Desmopressin Acetate Trihydrate (CAS 62357-86-2) is a synthetic analogue of the natural pituitary hormone 8-arginine vasopressin (ADH). Within the Peptides and pharmaceutical research sectors, it is highly valued for its technical role as a selective vasopressin V2 receptor agonist, used primarily to study antidiuretic activities and the management of water balance in laboratory models. As a leading manufacturer of Desmopressin Acetate Trihydrate CAS 62357-86-2 based in China, Conscientia Industrial utilizes high-precision Solid-Phase Peptide Synthesis (SPPS) and advanced chromatographic purification to ensure maximum peptide purity and structural accuracy. Our product maintains a strict analytical profile to meet global technical requirements for consistency in complex biochemical research. Technical Specifications Product Name: Desmopressin Acetate Trihydrate CAS Number: 62357-86-2 Sequence: Mpr-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2 Category: Peptides Quality Standard: USP / In-House Molecular Formula: C46H64N14O12S2.C2H4O2.3(H2O) Molecular Weight: 1183.31 Appearance: White or almost white powder Purity (HPLC): ≥98.0% Water Content: ≤5.0% Acetate Content: 3.0%–15.0% Solubility: Soluble in water and 1% acetic acid Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Advanced Peptide Synthesis: We utilize state-of-the-art Solid Phase Peptide Synthesis (SPPS) to ensure the precise sequence of Desmopressin Acetate. Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Desmopressin Acetate Trihydrate CAS 62357-86-2. Advanced Analytical Verification: Every batch is validated through HPLC and Mass Spectrometry to confirm chemical identity and minimize related peptide impurities. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Desmopressin Acetate Trihydrate CAS 62357-86-2. Scalable Production Capacity: Our China facility is equipped to support projects ranging from milligram-scale research to large-scale bulk industrial supply. Direct Source Advantage: As a primary manufacturer, we provide Desmopressin Acetate Trihydrate CAS 62357-86-2 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 1g, 10g, 100g in vials; 1kg in vacuum-sealed aluminum foil bags for bulk supply. Storage Conditions: Store in a tightly closed container at -20°C for long-term stability. Protected from light and moisture. Shelf Life: 24 months when stored under optimized industrial conditions. Safety Handling: This material is a technical-grade chemical intended for industrial production and laboratory research use only. Our logistics team ensures secure distribution of Desmopressin Acetate Trihydrate CAS 62357-86-2 via global courier, and air freight. Request a Quote & COA for Desmopressin Acetate Trihydrate CAS 62357-86-2 Today. Related Products Beinaglutide Human β-Defensin-2 Z-Phe-Gly-OH Secretin (Canine) Osteogenic Growth Peptide Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Angiotensin II 5-Valine | CAS 58-49-1 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Angiotensin II 5-Valine CAS 58-49-1? Conscientia Industrial is a leading manufacturer & supplier of high-purity Angiotensin II 5-Valine in China, offering ≥98.0% purity of Valine Angiotensin II, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. ISO certified, GMP compliance. Home > Peptides > Angiotensin II 5-Valine Angiotensin II 5-Valine | CAS 58-49-1 Manufacturer & Supplier in China Looking for Angiotensin II 5-Valine CAS 58-49-1? Conscientia Industrial is a leading manufacturer & supplier of high-purity Angiotensin II 5-Valine in China, offering ≥98.0% purity of Valine Angiotensin II, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial now. Product Overview Angiotensin II 5-Valine (CAS 58-49-1), also known as Valine Angiotensin II or [Val5] Angiotensin II, is a potent octapeptide and a primary effector of the renin-angiotensin system, characterized by the presence of valine at the fifth amino acid position. Within the Peptides and biochemical research sectors, it is highly valued for its technical role in studying vasoconstriction, aldosterone secretion, and blood pressure regulation in laboratory models. As a leading manufacturer of Angiotensin II 5-Valine CAS 58-49-1 based in China, Conscientia Industrial utilizes advanced solid-phase peptide synthesis (SPPS) and multi-stage purification to ensure the highest structural integrity and exact sequence fidelity. Our product maintains a strict purity profile to meet global technical requirements for cardiovascular research and advanced analytical applications. Technical Specifications Product Name: Angiotensin II 5-Valine Synonyms: Valine Angiotensin II; [Val5] Angiotensin II CAS Number: 58-49-1 Sequence: Asp-Arg-Val-Tyr-Val-His-Pro-Phe Category: Peptides Quality Standard: In-House Molecular Formula: C49H69N13O12 Molecular Weight: 1032.15 Appearance: White or off-white lyophilized powder Purity (HPLC): ≥98.0% Water Content: ≤8.0% Acetate Content: ≤15.0% Solubility: Soluble in water or aqueous buffer Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Angiotensin II 5-Valine CAS 58-49-1. Advanced Analytical Verification: Every batch is validated through HPLC and Mass Spectrometry (MS) to confirm chemical identity and minimize related substances. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Angiotensin II 5-Valine CAS 58-49-1. Scalable Production Capacity: Our China facility is equipped to support projects ranging from milligram-scale laboratory research to large-scale bulk industrial supply. Direct Source Advantage: As a primary manufacturer, we provide Angiotensin II 5-Valine CAS 58-49-1 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 5mg, 100mg, 1g, 10g lyophilized powder in vials or vacuum-sealed bags with protective thermal insulation. Storage Conditions: Store in a tightly closed container at -20°C for long-term stability. Protected from light and moisture. Shelf Life: 24 months when stored properly under recommended conditions. Safety Handling: This material is a technical-grade chemical intended for industrial production and laboratory research use only. Our logistics team ensures secure distribution of Angiotensin II 5-Valine CAS 58-49-1 via global courier, and air freight. Request a Quote & COA for Angiotensin II 5-Valine CAS 58-49-1 Today. Related Products Abarelix Acetate Histrelin Type A Allatostatin IV Orexin A TRV-120027 Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Neurotensin | CAS 39379-15-2 API Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Neurotensin CAS 39379-15-2? Conscientia Industrial is Neurotensin API manufacturer & supplier in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. ISO certified, GMP compliance. Home > Peptides > Neurotensin Neurotensin | CAS 39379-15-2 API Manufacturer & Supplier in China Looking for Neurotensin CAS 39379-15-2? Conscientia Industrial is Neurotensin API manufacturer & supplier in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. Product Overview Neurotensin (CAS 39379-15-2) is a 13-amino acid neuropeptide that regulates central nervous system signaling and gastrointestinal processes. As a leading manufacturer of Neurotensin in China, Conscientia Industrial produces this peptide via solid-phase peptide synthesis (SPPS) followed by liquid chromatography purification. Technical Specifications Product Name: Neurotensin CAS Number: 39379-15-2 Sequence: Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu Category: Peptides Quality Standard: In-House Specification Molecular Formula: C74H114N20O17 Molecular Weight: 1672.92 Appearance: White to off-white powder Purity (HPLC): ≥98.0% Single Impurity: ≤1.0% Water Content: ≤8.0% Acetate Content: ≤15.0% Solubility: Soluble in water Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Molecular Structure: Why Partner with Conscientia Industrial Standardized Manufacturing: We manufacture Neurotensin in GMP-compliant facilities under strict quality controls. Technical Quality Control: Our laboratory tests each batch of Neurotensin using HPLC and MS to confirm identity and purity. Full Technical Documentation: We supply COA, MSDS, and MOA documentation for Neurotensin (CAS 39379-15-2). Scalable Production Capacity: Our China plant provides Neurotensin from milligram scale for R&D to bulk quantities. Direct Source Advantage: As a direct producer, we offer competitive pricing and steady inventory for Neurotensin. Packaging & Storage Standard Packaging: 10mg, 100mg, 1g, 10g, 100g in vials or bottles. Storage Conditions: Store at -20°C. Keep the container tightly sealed and protected from light and moisture to maintain peptide stability. Shelf Life: 24 months when stored properly under recommended conditions. Safety Handling: This is a technical-grade API intended for industrial production and laboratory research use only. Shipping & Quotes Our logistics team ensures the safe and secure global shipping of Neurotensin (CAS 39379-15-2) via international courier, air freight, and sea freight. Request a Quote & COA for Neurotensin CAS 39379-15-2 Now. Related Products P21 Pinealon Triptorelin Acetate alpha-MSH free acid Acetyl Tetrapeptide-15 Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

  • Luteolin 7-Diglucuronide | CAS 96400-45-2 Manufacturer & Supplier in China | Conscientia Industrial

    High-purity Luteolin 7-Diglucuronide (CAS 96400-45-2) manufacturer in China. Offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial. ISO certified, GMP compliance. Home > Plant Extracts > Luteolin 7-Diglucuronide Luteolin 7-Diglucuronide | CAS 96400-45-2 Manufacturer & Supplier in China High-purity Luteolin 7-Diglucuronide (CAS 96400-45-2) manufacturer in China. Offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial. Product Overview Luteolin 7-Diglucuronide (CAS 96400-45-2) is a specialized flavonoid glycoside structurally characterized as the 7-O-diglucuronide derivative of luteolin. Within the Plant Extracts and phytochemical research sectors, it is highly prioritized as a technical analytical standard for laboratory investigation and the calibration of sophisticated detection equipment. As a leading manufacturer based in China, Conscientia Industrial utilizes precision separation and advanced extraction protocols to ensure the highest structural integrity of Luteolin 7-Diglucuronide (CAS 96400-45-2). Our product serves as a vital technical component for high-end biochemical research and secondary metabolite profiling, maintaining a strict purity profile to meet global technical requirements for chemical consistency. Technical Specifications Product Name: Luteolin 7-Diglucuronide CAS Number: 96400-45-2 Category: Plant Extracts Source: Verbena officinalis / Botanical sources Quality Standard: In-House Purity (HPLC): ≥98.0% Molecular Formula: C27H26O18 Molecular Weight: 638.48 Appearance: Yellow crystalline powder Loss on Drying: ≤1.0% Residue on Ignition: ≤0.1% Solubility: Soluble in Methanol, DMSO, and Water Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Luteolin 7-Diglucuronide CAS 96400-45-2. Advanced Analytical Verification: Every batch is validated through HPLC and NMR to confirm chemical identity and minimize secondary components during the purification stage. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for all technical applications. Scalable Production Capacity: Our China facility is equipped to support projects ranging from small-scale laboratory trials to specialized industrial supply volumes. Direct Source Advantage: As a primary manufacturer, we provide Luteolin 7-Diglucuronide CAS 96400-45-2 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 10mg/vial, 100mg/vial, or customized packaging options based on industrial requirements. Storage Conditions: Store in a tightly closed container in a cool, dry environment. Protected from light and moisture. Long-term storage at -20°C is recommended for stability. Safety Handling: This material is a technical-grade chemical intended for industrial production and laboratory research use only. Our logistics team ensures secure distribution of Luteolin 7-Diglucuronide CAS 96400-45-2 via global courier and air freight. Request a Quote & COA for Luteolin 7-Diglucuronide CAS 96400-45-2 Today. Related Products Hederasaponin B Phorbol Sipeimine Securinine (S)-Moluccanin Featured Peptides 98%+ HPLC Purity Liraglutide Pancragen Type A Allatostatin I Woodtide Degarelix Acetate Expert Review Rating: 5/5 ★★★★★ Mark Jensen (Production Manager) The extract shows consistent quality with a well-controlled active compound profile. It performs reliably in both liquid and powder formulations, with good color stability and low odor impact. Overall performance remains excellent for our cosmetic and nutraceutical applications.

  • Magainin I | CAS 108433-99-4 Manufacturer & Supplier in China | Conscientia Industrial

    Looking for Magainin I CAS 108433-99-4? Conscientia Industrial is Magainin I manufacturer & supplier in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. ISO certified, GMP compliance. Home > Peptides > Magainin I Magainin I | CAS 108433-99-4 Manufacturer & Supplier in China Looking for Magainin I CAS 108433-99-4? Conscientia Industrial is Magainin I manufacturer & supplier in China, offering ≥98.0% purity, stable industrial supply, and fast global shipping. Request Price, COA, and MSDS from Conscientia Industrial right now. Product Overview Magainin I (CAS 108433-99-4) is a prominent naturally occurring antimicrobial peptide originally isolated from the skin of the African clawed frog, Xenopus laevis. Within the Peptides and advanced biochemical research sectors, this amphipathic alpha-helical peptide is highly regarded for its technical capacity to investigate membrane-disruption mechanisms and broad-spectrum defensive pathways against various microorganisms in laboratory models. As a leading manufacturer of Magainin I CAS 108433-99-4 based in China, Conscientia Industrial utilizes advanced solid-phase peptide synthesis (SPPS) and multi-stage purification to ensure the highest structural integrity and precise amino acid sequencing. Our product maintains a strict purity profile to meet global technical requirements for peptide-based drug development, innate immunity research, and advanced biopharmaceutical applications. Technical Specifications Product Name: Magainin I Synonyms: Magainin 1 CAS Number: 108433-99-4 Sequence: Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser Category: Peptides Quality Standard: In-House Specification Molecular Formula: C112H177N29O28S Molecular Weight: 2409.85 Appearance: White or off-white lyophilized powder Purity (HPLC): ≥98.0% Water Content: ≤8.0% Acetate Content: ≤15.0% Solubility: Soluble in water or aqueous buffers Brand: Conscientia Industrial Country of Origin: China Availability: In Stock Pricing: Competitive price based on order quantity Currency: USD Molecular Structure: Why Partner with Conscientia Industrial Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Magainin I CAS 108433-99-4. Advanced Analytical Verification: Every batch of Magainin I is validated through HPLC and Mass Spectrometry (MS) to confirm chemical identity and ensure precise peptide purity. Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Magainin I CAS 108433-99-4. Scalable Production Capacity: Our China facility is equipped to support projects ranging from milligram-scale research to large-scale bulk industrial peptide supply. Direct Source Advantage: As a primary manufacturer, we provide Magainin I CAS 108433-99-4 with efficient lead times and direct factory technical support. Packaging & Storage Standard Packaging: 1mg, 10mg, 100mg, 1g, 10g, 100g lyophilized powder in vials or vacuum-sealed bags with protective thermal insulation. Storage Conditions: Store in a tightly closed container at -20°C for long-term stability. Protected from light and moisture. Shelf Life: 24 months from the manufacturing date when stored under correct recommended conditions. Safety Handling: This material is a technical-grade chemical intended for industrial production and laboratory research use only. Our logistics team ensures secure distribution of Magainin I CAS 108433-99-4 via global courier, air freight, and sea freight. Request a Quote & COA for Magainin I CAS 108433-99-4 Today. Related Products Palmitoyl Tripeptide-5 Felypressin beta-Amyloid (1-38) Caprooyl-Tetrapeptide-3 Seglitide Acetate Expert Review Rating: 5/5 ★★★★★ Marcus V. (Senior Research Scientist) The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

bottom of page