Dulaglutide API | CAS 923950-08-7 Manufacturer & Supplier in China

Product Overview

Dulaglutide (CAS 923950-08-7) is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist designed through recombinant DNA technology. It consists of two identical disulfide-linked chains, each containing a human GLP-1 analogue sequence covalently linked to a modified human immunoglobulin G4 (IgG4) heavy chain fragment. Within the Peptides and biopharmaceutical research sectors, Dulaglutide is highly valued for its technical capacity to enhance glucose-dependent insulin secretion and suppress glucagon release in advanced biochemical models. As a leading manufacturer of Dulaglutide CAS 923950-08-7 based in China, Conscientia Industrial utilizes precision biotechnology and high-resolution purification platforms to ensure the highest structural integrity and sequence fidelity. Our product maintains a strict purity profile to meet global technical requirements for large-molecule peptide research and batch-to-batch consistency in therapeutic development.

Technical Specifications

• Product Name: Dulaglutide

• CAS Number: 923950-08-7

• Sequence: HGEGTFTSDV SSYLEEQAAK EFIAWLVKGG GGGGGSGGGG SGGGGSAESK YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

• Category: Peptide

• Quality Standard: In-House

• Purity (HPLC): ≥98.0%

• Molecular Formula: C2646H4044N704O836S18

• Molecular Weight: 59669.93

• Appearance: White to off-white powder

• Single Impurity: ≤1.0%

• Water Content: ≤8.0%

• Acetate Content: ≤15.0%

• Brand: Conscientia Industrial

• Country of Origin: China

• Availability: In Stock

• Pricing: Competitive price based on order quantity

• Currency: USD

• Molecular Structure:

Why Partner with Conscientia Industrial

• Expertise in Complex Peptides: Specialized in the synthesis and purification of long-chain and fusion protein analogues with high structural precision.

• Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Dulaglutide CAS 923950-08-7.

• Advanced Analytical Verification: Every batch is validated through Size Exclusion Chromatography (SEC-HPLC) and Peptide Mapping to confirm chemical identity and ensure minimal high-molecular-weight aggregates.

• Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Dulaglutide CAS 923950-08-7.

• Scalable Production Capacity: Our China facility is equipped to support projects ranging from pilot-scale laboratory research to large-scale bulk industrial supply of recombinant peptides.

• Direct Source Advantage: As a primary manufacturer, we provide Dulaglutide CAS 923950-08-7 with efficient lead times and direct factory technical support.

Packaging & Storage

• Standard Packaging: 10mg, 100mg, 1g, 10g, 100g in sealed aluminum foil bags.

• Storage Conditions: Store at -20°C. Keep the container tightly sealed and protected from light and moisture to maintain maximum stability for Dulaglutide CAS 923950-08-7.

• Shelf Life: 24 months when stored under recommended conditions.

• Safety Handling: This is a professional-grade API intended for industrial production and laboratory research use only.

Our logistics team ensures safe delivery of Dulaglutide CAS 923950-08-7 by courier, and by air.

Request a Quote & COA for Dulaglutide CAS 923950-08-7 Today.