Product Overview
GLP-1 (7-36) Amide (CAS 107444-51-9) is an endogenous incretin peptide hormone that plays a major role in glucose homeostasis, insulin secretion, and metabolic regulation research. In endocrinology and metabolic disease studies, this peptide is utilized to evaluate pancreatic beta-cell receptor activation, gastric emptying dynamics, and pathway signaling. Conscientia Industrial synthesizes GLP-1 (7-36) Amide through automated solid-phase peptide synthesis and chromatographic purification.
Technical Specifications
| Product Name: | GLP-1 (7-36) Amide |
| CAS Number: | 107444-51-9 |
| Category: | Peptides |
| Peptide Length: | 30 Amino Acids |
| One-letter Sequence: | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Three-letter Sequence: | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Formula: | C149H226N40O45 |
| Molecular Weight: | 3297.68 |
| Quality Standard: | In-House Specification |
| Appearance: | White to off-white lyophilized powder |
| Purity (HPLC): | ≥98.0% |
| Alternative Grade: | ≥95.0% |
| Water Content: | ≤10.0% |
| Acetate Salt Form: | Acetate Content ≤15.0% |
| Trifluoroacetate Salt Form: | TFA Content ≤15.0% |
| Manufacturer: | Conscientia Industrial |
| Brand: | Conscientia Industrial |
| Country of Origin: | China |
Why Choose Conscientia Industrial
- Quality Assurance: GLP-1 (7-36) Amide is verified by HPLC and mass spectrometry to ensure precise sequence accuracy and batch consistency.
- Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are provided for each batch of GLP-1 (7-36) Amide CAS 107444-51-9.
- Production Capacity: Robust peptide synthesis infrastructure supports custom order volumes from milligram evaluation lots to bulk commercial manufacturing.
- Direct Supply: Direct factory manufacturing guarantees stable stock, competitive direct pricing, and dedicated technical support.
Packaging & Storage
- Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
- Storage Condition: Store sealed at -20°C in a dry and dark place.
- Shelf Life: 24 months when properly stored under recommended conditions.
- Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
- Conscientia Industrial provides worldwide logistics solutions for GLP-1 (7-36) Amide (CAS 107444-51-9), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
- Contact us today for the latest quotation, COA, SDS, and technical documentation.
评价
目前还没有评价