Product Overview
Amylin (8-37), rat (CAS 138398-61-5) is a potent peptide antagonist of amylin and CGRP receptors, widely used in metabolic regulation and diabetes research. In physiological studies, this truncated peptide is applied to evaluate glucose homeostasis, insulin resistance, and food intake signaling pathways. Conscientia Industrial manufactures high-purity rat Amylin (8-37) via automated solid-phase peptide synthesis followed by preparative HPLC purification.
Technical Specifications
| Product Name: | Amylin (8-37), rat |
| Synonyms: | Rat Amylin-(8-37) |
| CAS Number: | 138398-61-5 |
| Category: | Peptides |
| Peptide Length: | 30 Amino Acids |
| One-letter Sequence: | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| Three-letter Sequence: | Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 |
| Molecular Formula: | C140H227N43O43 |
| Molecular Weight: | 3200.61 |
| Quality Standard: | In-House Specification |
| Appearance: | White to off-white lyophilized powder |
| Purity (HPLC): | ≥98.0% |
| Alternative Grade: | ≥95.0% |
| Water Content: | ≤10.0% |
| Acetate Salt Form: | Acetate Content ≤15.0% |
| Trifluoroacetate Salt Form: | TFA Content ≤15.0% |
| Manufacturer: | Conscientia Industrial |
| Brand: | Conscientia Industrial |
| Country of Origin: | China |
Why Choose Conscientia Industrial
- Quality Assurance: Amylin (8-37), rat is verified by HPLC and mass spectrometry to ensure structural accuracy and high purity.
- Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are provided for each batch of Amylin (8-37), rat CAS 138398-61-5.
- Production Capacity: Synthesis infrastructure supports flexible orders from milligram research quantities to bulk batch manufacturing.
- Direct Supply: Direct factory supply ensures stable inventory, competitive pricing, and technical support.
Packaging & Storage
- Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
- Storage Condition: Store sealed at -20°C in a dry and dark place.
- Shelf Life: 24 months when properly stored under recommended conditions.
- Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
- Conscientia Industrial provides worldwide logistics solutions for Amylin (8-37), rat (CAS 138398-61-5), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
- Contact us today for the latest quotation, COA, SDS, and technical documentation.
评价
目前还没有评价