Dulaglutide CAS 923950-08-7

Product Overview

Dulaglutide (CAS 923950-08-7) is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist designed through recombinant DNA technology. It consists of two identical disulfide-linked chains, each containing a human GLP-1 analogue sequence covalently linked to a modified human immunoglobulin G4 (IgG4) heavy chain fragment. Within the Peptides and biopharmaceutical research sectors, Dulaglutide is highly valued for its technical capacity to enhance glucose-dependent insulin secretion and suppress glucagon release in advanced biochemical models. As a professitional manufacturer of Dulaglutide CAS 923950-08-7 based in China, Conscientia Industrial utilizes precision biotechnology and high-resolution purification platforms to ensure the highest structural integrity and sequence fidelity. Our product maintains a strict purity profile to meet global technical requirements for large-molecule peptide research and batch-to-batch consistency in therapeutic development.

Technical Specifications

• Product Name: Dulaglutide
• CAS Number: 923950-08-7
• Sequence: HGEGTFTSDV SSYLEEQAAK EFIAWLVKGG GGGGGSGGGG SGGGGSAESK YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
• Category: Peptide
• Quality Standard: In-House
• Purity (HPLC): ≥98.0%
• Molecular Formula: C2646H4044N704O836S18
• Molecular Weight: 59669.93
• Appearance: White to off-white powder
• Single Impurity: ≤1.0%
• Water Content: ≤8.0%
• Acetate Content: ≤15.0%
• Brand: Conscientia Industrial
• Country of Origin: China

Why Choose Conscientia Industrial

• Expertise in Complex Peptides: Specialized in the synthesis and purification of long-chain and fusion protein analogues with high structural precision.
• Technical Quality Control: Our manufacturing process follows rigorous analytical protocols to ensure high-grade batch-to-batch consistency for Dulaglutide CAS 923950-08-7.
• Advanced Analytical Verification: Every batch is validated through Size Exclusion Chromatography (SEC-HPLC) and Peptide Mapping to confirm chemical identity and ensure minimal high-molecular-weight aggregates.
• Full Technical Documentation: We provide comprehensive support, including Certificate of Analysis (COA), MSDS, and Method of Analysis (MOA) for Dulaglutide CAS 923950-08-7.
• Scalable Production Capacity: Our China facility is equipped to support projects ranging from pilot-scale laboratory research to large-scale bulk industrial supply of recombinant peptides.
• Direct Source Advantage: As a primary manufacturer, we provide Dulaglutide CAS 923950-08-7 with efficient lead times and direct factory technical support.

Packaging & Storage

• Standard Packaging: 10mg, 100mg, 1g, 10g, 100g in sealed aluminum foil bags.
• Storage Conditions: Store at -20°C. Keep the container tightly sealed and protected from light and moisture to maintain maximum stability for Dulaglutide CAS 923950-08-7.
• Shelf Life: 24 months when stored under recommended conditions.
• Safety Handling: This is a professional-grade API intended for industrial production and laboratory research use only.

Our logistics team ensures safe delivery of Dulaglutide CAS 923950-08-7 by courier, and by air.

Request a Quote & COA for Dulaglutide CAS 923950-08-7 Today.