Conscientia Industrial Co., Ltd
β-Endorphin (rat)
β-Endorphin (rat) | CAS 309246-19-3 Manufacturer & Supplier in China
Conscientia Industrial is a professional manufacturer and supplier of β-Endorphin (rat) CAS 309246-19-3 in China, offering ≥98.0% purity, reliable supply, complete technical documentation and global shipping. Contact us for the latest price and COA.
Product Overview
β-Endorphin (rat) (CAS 309246-19-3) is an endogenous opioid neuropeptide widely utilized in neurobiology, pain pathway studies, and endocrine receptor research. Researchers actively investigate its binding affinity and physiological regulatory mechanisms across central nervous system signaling pathways. To ensure exceptional quality and lot-to-lot reliability, Conscientia Industrial manufactures high-purity β-Endorphin (rat) using advanced solid-phase peptide synthesis and precise chromatographic purification techniques.
Technical Specifications
Product Name: | β-Endorphin (rat) |
CAS Number: | 309246-19-3 |
Another CAS Number: | |
Category: | Peptides |
Peptide Length: | 31 Amino Acids |
One-letter Sequence: | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
Three-letter Sequence: | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
Molecular Formula: | C157H254N42O44S |
Molecular Weight: | 3466.02 |
Quality Standard: | In-House Specification |
Appearance: | White to off-white lyophilized powder |
Purity (HPLC): | ≥98.0% |
Alternative Grade: | ≥95.0% |
Water Content: | ≤10.0% |
Acetate Salt Form: | Acetate Content ≤15.0% |
Trifluoroacetate Salt Form: | TFA Content ≤15.0% |
Manufacturer: | Conscientia Industrial |
Brand: | Conscientia Industrial |
Country of Origin: | China |
Availability: | In Stock |
Molecular Structure
Why Choose Conscientia Industrial
Quality Assurance: High-purity β-Endorphin (rat) is verified by high-performance liquid chromatography and mass spectrometry to ensure batch-to-batch consistency.
Documentation: Complete quality compliance documents including Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are available for β-Endorphin (rat) CAS 309246-19-3.
Production Capacity: Scalable peptide synthesis infrastructure supports custom order volumes from milligram evaluation lots to bulk commercial manufacturing.
Direct Source Advantage: Conscientia Industrial delivers competitive pricing, reliable delivery time, and expert technical support for international research partners.
Packaging & Storage
Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
Storage Condition: Store sealed at -20°C in a dry and dark place.
Shelf Life: 24 months when properly stored under recommended conditions.
Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
Conscientia Industrial provides worldwide logistics solutions for β-Endorphin (rat) (CAS 309246-19-3), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
Contact us today for the latest quotation, COA, SDS, and technical documentation.
Expert Review
Rating: 5/5
★★★★★ Marcus V. (Senior Research Scientist)
The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.