top of page

Home > Peptides >

β-Amyloid (1-46)

β-Amyloid (1-46) | CAS 285554-31-6 Manufacturer & Supplier in China

Conscientia Industrial is a professional manufacturer and supplier of β-Amyloid (1-46) CAS 285554-31-6 in China, offering ≥98.0% purity, reliable supply, complete technical documentation and global shipping. Contact us for the latest price and COA.

Product Overview

β-Amyloid (1-46) (CAS 285554-31-6) is a long C-terminal isoform of the amyloid-beta peptide, primarily studied in Alzheimer's disease pathology and neurodegeneration research. In biochemical assays, this neurotoxic peptide is applied to evaluate amyloid aggregation kinetics, protofibril formation, and neurovascular toxicity mechanisms. Conscientia Industrial produces high-purity β-Amyloid (1-46) using automated solid-phase peptide synthesis and specialized HPLC purification protocols.


Technical Specifications

Product Name:

β-Amyloid (1-46)

CAS Number:

285554-31-6

Category:

Peptides

Peptide Length:

46 Amino Acids

One-letter Sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV

Three-letter Sequence:

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val

Molecular Formula:

C223H347N59O65S

Molecular Weight:

4926.61

Quality Standard:

In-House Specification

Appearance:

White to off-white lyophilized powder

Purity (HPLC):

≥98.0%

Alternative Grade:

≥95.0%

Water Content:

≤10.0%

Acetate Salt Form:

Acetate Content ≤15.0%

Trifluoroacetate Salt Form:

TFA Content ≤15.0%

Manufacturer:

Conscientia Industrial

Brand:

Conscientia Industrial

Country of Origin:

China

Availability:

In Stock


Molecular Structure


beta-Amyloid (1-46) CAS 285554-31-6 Molecular Structure


Why Choose Conscientia Industrial

  • Quality Assurance: β-Amyloid (1-46) is analyzed by analytical HPLC and mass spectrometry to verify sequence identity, purity, and molecular weight.

  • Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are provided for β-Amyloid (1-46) CAS 285554-31-6.

  • Production Capacity: Advanced peptide synthesis capability accommodates requirements from milligram-scale research samples to commercial batches.

  • Direct Supply: Factory-direct production ensures consistent quality control, competitive pricing, and knowledgeable customer service.


Packaging & Storage

  • Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.

  • Storage Condition: Store sealed at -20°C in a dry and dark place.

  • Shelf Life: 24 months when properly stored under recommended conditions.

  • Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.


Shipping & Quotes

  • Conscientia Industrial provides worldwide logistics solutions for β-Amyloid (1-46) (CAS 285554-31-6), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.

  • Contact us today for the latest quotation, COA, SDS, and technical documentation.

Related Products
alpha-Conotoxin SI
HCGRP-(8-37)
Mecasermin
Davunetide
Taltirelin

Expert Review
Rating: 5/5
★★★★★ Marcus V. (Senior Research Scientist)
The peptide exhibits strong consistency in purity and structure, with reliable delivery and performance in our research applications. Highly recommended.

bottom of page