Product Overview
(D-Ala2)-GIP (human) (CAS 444073-04-5) is a dipeptidyl peptidase IV (DPP-IV)-resistant analog of human gastric inhibitory polypeptide (GIP). In metabolic research, this peptide is used to study glucose-dependent insulinotropic polypeptide receptor activation, insulin secretion mechanisms, and glucose homeostasis. Conscientia Industrial produces (D-Ala2)-GIP (human) via solid-phase peptide synthesis and HPLC purification.
Technical Specifications
| Product Name: | (D-Ala2)-GIP (human) |
| Synonyms: | (D-Ala2)-Gastric Inhibitory Polypeptide (human) |
| CAS Number: | 444073-04-5 |
| Category: | Peptides |
| Peptide Length: | 42 Amino Acids |
| One-letter Sequence: | Y(D-Ala)EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Three-letter Sequence: | Tyr-D-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Molecular Formula: | C226H338N60O66S |
| Molecular Weight: | 4983.60 |
| Quality Standard: | In-House Specification |
| Appearance: | White to off-white lyophilized powder |
| Purity (HPLC): | ≥98.0% |
| Alternative Grade: | ≥95.0% |
| Acetate Salt Form: | Acetate Content ≤15.0% |
| Trifluoroacetate Salt Form: | TFA Content ≤15.0% |
| Manufacturer: | Conscientia Industrial |
| Brand: | Conscientia Industrial |
| Country of Origin: | China |
Why Choose Conscientia Industrial
- Quality Assurance: Every batch of (D-Ala2)-GIP (human) is verified by HPLC and mass spectrometry to ensure consistent structural accuracy and high purity.
- Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are provided to support regulatory compliance and technical requirements.
- Production Capacity: Synthesis infrastructure supports flexible orders from milligram research quantities to bulk batch manufacturing.
- Direct Supply: Direct factory supply ensures stable inventory, competitive pricing, and technical support.
Packaging & Storage
- Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
- Storage Condition: Store sealed at -20°C in a dry and dark place.
- Shelf Life: 24 months when properly stored under recommended conditions.
- Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
- Conscientia Industrial provides worldwide logistics solutions for (D-Ala2)-GIP (human) (CAS 444073-04-5), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
- Contact us today for the latest quotation, COA, SDS, and technical documentation.
评价
目前还没有评价