Product Overview
β-Amyloid (1-40) (rat) (CAS 144409-98-3) is a synthetic 40-amino acid peptide corresponding to the rat amyloid beta-protein sequence for neurodegenerative disease research. This neurotoxic peptide fragment is widely utilized in biochemical assays to study amyloid fibril formation, neurotoxicity mechanisms, and Alzheimer’s disease pathology. To guarantee consistent quality, Conscientia Industrial manufactures high-purity β-Amyloid (1-40) (rat) through precise solid-phase peptide synthesis and advanced chromatographic purification techniques.
Technical Specifications
| Product Name: | β-Amyloid (1-40) (rat) |
| CAS Number: | 144409-98-3 |
| Category: | Peptides |
| Peptide Length: | 40 Amino Acids |
| One-letter Sequence: | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Three-letter Sequence: | Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Molecular Formula: | C190H291N51O57S |
| Molecular Weight: | 4233.72 |
| Quality Standard: | In-House Specification |
| Appearance: | White to off-white lyophilized powder |
| Purity (HPLC): | ≥98.0% |
| Alternative Grade: | ≥95.0% |
| Manufacturer: | Conscientia Industrial |
| Brand: | Conscientia Industrial |
| Country of Origin: | China |
Why Choose Conscientia Industrial
- Quality Assurance: High-purity β-Amyloid (1-40) (rat) is verified by high-performance liquid chromatography and mass spectrometry to ensure batch-to-batch consistency.
- Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are available for β-Amyloid (1-40) (rat) CAS 144409-98-3.
- Production Capacity: Scalable peptide synthesis infrastructure supports custom order volumes from milligram evaluation lots to bulk commercial manufacturing.
- Direct Source Advantage: Conscientia Industrial delivers competitive pricing, reliable delivery time, and expert technical support.
Packaging & Storage
- Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
- Storage Condition: Store sealed at -20°C in a dry and dark place.
- Shelf Life: 24 months when properly stored under recommended conditions.
- Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
- Conscientia Industrial provides worldwide logistics solutions for β-Amyloid (1-40) (rat) (CAS 144409-98-3), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
- Contact us today for the latest quotation, COA, SDS, and technical documentation.



评价
目前还没有评价