Product Overview
β-Amyloid (40-1) (CAS 144409-99-4) is the reverse-sequence peptide control for β-Amyloid (1-40), widely used in Alzheimer’s disease research and neurotoxicity assays. In neurobiology studies, this peptide is utilized as a biological control to evaluate non-specific cellular responses and peptide aggregation mechanisms. Conscientia Industrial synthesizes β-Amyloid (40-1) through solid-phase peptide synthesis and precise chromatographic purification.
Technical Specifications
| Product Name: | β-Amyloid (40-1) |
| Synonyms: | Amyloid β-Protein (40-1) |
| CAS Number: | 144409-99-4 |
| Category: | Peptides |
| Peptide Length: | 40 Amino Acids |
| One-letter Sequence: | VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Three-letter Sequence: | Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH |
| Molecular Formula: | C194H295N53O58S |
| Molecular Weight: | 4329.80 |
| Quality Standard: | In-House Specification |
| Appearance: | White to off-white lyophilized powder |
| Purity (HPLC): | ≥98.0% |
| Alternative Grade: | ≥95.0% |
| Water Content: | ≤10.0% |
| Acetate Salt Form: | Acetate Content ≤15.0% |
| Trifluoroacetate Salt Form: | TFA Content ≤15.0% |
| Manufacturer: | Conscientia Industrial |
| Brand: | Conscientia Industrial |
| Country of Origin: | China |
Why Choose Conscientia Industrial
- Quality Assurance: β-Amyloid (40-1) is verified by HPLC and mass spectrometry to ensure structural accuracy and batch consistency.
- Documentation: Certificate of Analysis (COA), Safety Data Sheet (SDS), and Method of Analysis (MOA) are provided for β-Amyloid (40-1) CAS 144409-99-4.
- Production Capacity: Synthesis infrastructure supports flexible order volumes from milligram research lots to bulk commercial production.
- Direct Supply: Direct factory supply ensures stable inventory, competitive pricing, and dedicated technical support.
Packaging & Storage
- Packaging: Available in 1mg, 5mg, 10mg, 50mg, 100mg, 500mg, 1g, 10g in vials or in aluminium foil bags. Customized packaging and private labeling services are available upon request.
- Storage Condition: Store sealed at -20°C in a dry and dark place.
- Shelf Life: 24 months when properly stored under recommended conditions.
- Safety Handling: This product is intended for research and industrial use only. It is not intended for human or veterinary diagnostic or therapeutic use. Handle with proper personal protective equipment.
Shipping & Quotes
- Conscientia Industrial provides worldwide logistics solutions for β-Amyloid (40-1) (CAS 144409-99-4), including international courier service, air freight, and sea freight. A complete set of shipping documents is provided to support international import and export requirements.
- Contact us today for the latest quotation, COA, SDS, and technical documentation.
评价
目前还没有评价